원본

Atlas Antibodies Anti-SGO1 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human shugoshin 1 (SGO1). Affinity-purified for high specificity. Suitable for ICC and other applications. Contains 40% glycerol and PBS buffer with sodium azide preservative.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069857-100 Anti-SGO1 Antibody, shugoshin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069857-25 Anti-SGO1 Antibody, shugoshin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SGO1 Antibody

Anti-SGO1 Antibody

Target Information

Target Protein: Shugoshin 1
Target Gene: SGO1
Alternative Gene Names: NY-BR-85, SGOL1

Product Description

Polyclonal antibody against human SGO1, produced in rabbit. Affinity purified using PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000023940 (36%)
Rat ENSRNOG00000022499 (34%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	ICC and other immunoassays
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.