CacheBy
Atlas Antibodies Anti-SFXN3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SFXN3 Antibody

상품 한눈에 보기

Human SFXN3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat에 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048105-100 Anti-SFXN3 Antibody, sideroflexin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048105-25 Anti-SFXN3 Antibody, sideroflexin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SFXN3 Antibody

Anti-SFXN3 Antibody

Target Information

  • Target Protein: sideroflexin 3
  • Target Gene: SFXN3
  • Alternative Gene Names: SFX3
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SFXN3.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    ESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMN

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000015442 93%
Mouse ENSMUSG00000025212 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 적용 농도 및 조건은 사용자 실험 환경에 따라 최적화가 필요합니다.
  • Open Datasheet

제품 이미지

Recommended Applications - IHC
Recommended Applications - WB
Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.