원본

Atlas Antibodies Anti-SFXN1 Antibody

상품 한눈에 보기

Human SFXN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 사람, 생쥐, 랫트에 반응합니다. RNA-seq 데이터 기반의 정교한 orthogonal 검증이 수행되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA063745-100 Anti-SFXN1 Antibody, sideroflexin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA063745-25 Anti-SFXN1 Antibody, sideroflexin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: sideroflexin 1 (SFXN1)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, orthogonal validation)
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against human SFXN1 (sideroflexin 1).

항목	내용
Target Protein	sideroflexin 1
Target Gene	SFXN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQV

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet