CacheBy
Atlas Antibodies Anti-SFMBT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SFMBT2 Antibody

상품 한눈에 보기

Human SFMBT2 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 Affinity purification 수행. 높은 종간 특이성(인간, 마우스, 랫트). 안정적인 PBS/glycerol buffer로 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035448-100 Anti-SFMBT2 Antibody, Scm-like with four mbt domains 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035448-25 Anti-SFMBT2 Antibody, Scm-like with four mbt domains 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SFMBT2 Antibody

Anti-SFMBT2 Antibody

Target Information

  • Protein: Scm-like with four mbt domains 2
  • Gene: SFMBT2
  • Alternative Gene Name: KIAA1617
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SFMBT2.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPF

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000061186 77%
Rat ENSRNOG00000029235 76%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.