CacheBy
Atlas Antibodies Anti-SESN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SESN1 Antibody

상품 한눈에 보기

Human SESN1 단백질을 인식하는 rabbit polyclonal 항체로, PrEST 항원을 이용해 친화정제됨. ICC 등 다양한 응용에 적합하며, 인간에 대한 검증된 반응성을 가짐. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073659-100 Anti-SESN1 Antibody, sestrin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073659-25 Anti-SESN1 Antibody, sestrin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SESN1 Antibody

Anti-SESN1 Antibody

Target Information

  • Target Protein: sestrin 1
  • Target Gene: SESN1
  • Alternative Gene Names: PA26, SEST1

Product Description

Polyclonal antibody against human SESN1.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.

Antigen Sequence:
ASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000038332) – 95%
  • Rat (ENSRNOG00000000302) – 93%
  • ICC (Immunocytochemistry)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.