
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SESN1 Antibody
상품 한눈에 보기
Human SESN1 단백질을 인식하는 rabbit polyclonal 항체로, PrEST 항원을 이용해 친화정제됨. ICC 등 다양한 응용에 적합하며, 인간에 대한 검증된 반응성을 가짐. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA073659-100 Anti-SESN1 Antibody, sestrin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073659-25 Anti-SESN1 Antibody, sestrin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SESN1 Antibody
Anti-SESN1 Antibody
Target Information
- Target Protein: sestrin 1
- Target Gene: SESN1
- Alternative Gene Names: PA26, SEST1
Product Description
Polyclonal antibody against human SESN1.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.
Antigen Sequence:
ASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYC
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000038332) – 95%
- Rat (ENSRNOG00000000302) – 93%
Recommended Applications
- ICC (Immunocytochemistry)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Links
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



