Atlas Antibodies Anti-SESN1 Antibody

상품 한눈에 보기

Human SESN1 단백질을 인식하는 rabbit polyclonal 항체로, PrEST 항원을 이용해 친화정제됨. ICC 등 다양한 응용에 적합하며, 인간에 대한 검증된 반응성을 가짐. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함.

카탈로그번호: HPA073659-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA073659-100 Anti-SESN1 Antibody, sestrin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA073659-25 Anti-SESN1 Antibody, sestrin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SESN1 Antibody

Anti-SESN1 Antibody

Target Information

Target Protein: sestrin 1
Target Gene: SESN1
Alternative Gene Names: PA26, SEST1

Product Description

Polyclonal antibody against human SESN1.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.

Antigen Sequence:
ASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYC

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000038332) – 95%
Rat (ENSRNOG00000000302) – 93%

Recommended Applications

ICC (Immunocytochemistry)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Storage	Gently mix before use. Optimal concentrations and conditions should be determined by the user.