CacheBy
Atlas Antibodies Anti-SESTD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SESTD1 Antibody

상품 한눈에 보기

인간 SESTD1 단백질을 표적으로 하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. SEC14 및 spectrin domain containing 1 단백질 검출에 적합하며, 고순도 Affinity 정제 방식으로 제조되었습니다. PBS/glycerol buffer에 보존되어 연구용으로 권장됩니다.

카탈로그번호
HPA077408-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077408-100 Anti-SESTD1 Antibody, SEC14 and spectrin domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077408-25 Anti-SESTD1 Antibody, SEC14 and spectrin domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SESTD1 Antibody

Anti-SESTD1 Antibody

Target Information

  • Target Protein: SEC14 and spectrin domain containing 1
  • Target Gene: SESTD1
  • Alternative Gene Names: DKFZp434O0515, Solo

Product Description

Polyclonal antibody against human SESTD1.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012603 (100%)
  • Mouse ENSMUSG00000042272 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

ICC (Immunocytochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)
Material Safety Data Sheet

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.