CacheBy
Atlas Antibodies Anti-SERPINE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINE3 Antibody

상품 한눈에 보기

인간 SERPINE3 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 기반 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.

카탈로그번호
HPA051904-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051904-100 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051904-25 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINE3 Antibody

Anti-SERPINE3 Antibody

Target: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Supplier: Atlas Antibodies

이미지 내 텍스트(OCR): IHC (Immunohistochemistry)

Product Description

Polyclonal Antibody against Human SERPINE3

Open Datasheet

Target Information

  • Target Protein: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
  • Target Gene: SERPINE3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGI

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Rat ENSRNOG00000009814 83%
Mouse ENSMUSG00000091155 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.