CacheBy
Atlas Antibodies Anti-SERPINE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINE3 Antibody

상품 한눈에 보기

인간 SERPINE3 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 기반 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA051904-100 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051904-25 Anti-SERPINE3 Antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINE3 Antibody

Anti-SERPINE3 Antibody

Target: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Supplier: Atlas Antibodies

이미지 내 텍스트(OCR): IHC (Immunohistochemistry)

Product Description

Polyclonal Antibody against Human SERPINE3

Open Datasheet

Target Information

  • Target Protein: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
  • Target Gene: SERPINE3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTASTIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGI

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Rat ENSRNOG00000009814 83%
Mouse ENSMUSG00000091155 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.