Atlas Antibodies Anti-SERPINB5 Antibody

상품 한눈에 보기

인간 SERPINB5 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 유전자 및 단백질 수준에서 검증된 고품질 항체. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019132-100 Anti-SERPINB5 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019132-25 Anti-SERPINB5 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: serpin peptidase inhibitor, clade B (ovalbumin), member 5
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Genetic validation): Genetic validation in Western Blot by siRNA knockdown.
ICC: Suitable for immunocytochemistry.

Polyclonal antibody against human SERPINB5.

maspin, PI5

항목	내용
Target Protein	serpin peptidase inhibitor, clade B (ovalbumin), member 5
Target Gene	SERPINB5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVD
Verified Species Reactivity	Human, Rat
Interspecies Identity	Rat ENSRNOG00000002640 (94%), Mouse ENSMUSG00000067006 (92%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.