CacheBy
Atlas Antibodies Anti-SERF1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERF1A Antibody

상품 한눈에 보기

Human SERF1A 단백질을 인식하는 고특이성 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 순도 제공. ICC 등 다양한 응용에 적합하며, Human 반응성이 검증됨. 안정적인 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA075271-100 Anti-SERF1A Antibody, small EDRK-rich factor 1A (telomeric) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075271-25 Anti-SERF1A Antibody, small EDRK-rich factor 1A (telomeric) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERF1A Antibody

Anti-SERF1A Antibody

Target: small EDRK-rich factor 1A (telomeric)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SERF1A.

Alternative Gene Names

4F5, FAM2A, H4F5, SERF1, SMAM1

Open Datasheet

Target Information

항목 내용
Target Protein small EDRK-rich factor 1A (telomeric)
Target Gene SERF1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000051768 (38%), Rat ENSRNOG00000051204 (38%)

Antigen Sequence:
SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.