CacheBy
Atlas Antibodies Anti-SEMA6B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEMA6B Antibody

상품 한눈에 보기

Human SEMA6B 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원을 이용한 친화 정제 방식. 다양한 조직에서 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체. PBS/glycerol buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055778-100 Anti-SEMA6B Antibody, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055778-25 Anti-SEMA6B Antibody, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEMA6B Antibody

Anti-SEMA6B Antibody

sema domain, transmembrane domain (TM), and cytoplasmic domain (semaphorin) 6B

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SEMA6B

Alternative Gene Names

SEM-SEMA-Y, SEMA-VIB, SEMAN, semaZ

Open Datasheet

Target Information

항목 내용
Target Protein sema domain, transmembrane domain (TM), and cytoplasmic domain (semaphorin) 6B
Target Gene SEMA6B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000001227 (89%), Rat ENSRNOG00000045998 (87%)

Antigen Sequence

AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.