CacheBy
Atlas Antibodies Anti-SELL Antibody
원본

Atlas Antibodies Anti-SELL Antibody

상품 한눈에 보기

Human SELL 단백질을 인식하는 Rabbit Polyclonal 항체로, selectin L 검출에 사용됩니다. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA051972-100 Anti-SELL Antibody, selectin L 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051972-25 Anti-SELL Antibody, selectin L 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SELL Antibody

Anti-SELL Antibody

Target: selectin L
Supplier: Atlas Antibodies


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human SELL (selectin L).


Alternative Gene Names

CD62L, hLHRc, LAM-1, LAM1, Leu-8, LNHR, LSEL, Lyam-1, LYAM1, PLNHR

Open Datasheet (PDF)


Target Information

  • Target Protein: selectin L
  • Target Gene: SELL

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000002776 60%
Mouse ENSMUSG00000026581 58%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. [Material Safety Data Sheet]
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.