CacheBy
Atlas Antibodies Anti-SELENON Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SELENON Antibody

상품 한눈에 보기

Human SELENON 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 및 ICC에 적합하며, PrEST 항원으로 정제됨. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유. PBS/glycerol buffer에 보존제 포함.

카탈로그번호
HPA058076-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058076-100 Anti-SELENON Antibody, selenoprotein N 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058076-25 Anti-SELENON Antibody, selenoprotein N 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SELENON Antibody

Anti-SELENON Antibody

Target Information

  • Target Protein: selenoprotein N
  • Target Gene: SELENON
  • Alternative Gene Names: MDRS1, RSMD1, RSS, SELN, SEPN1
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SELENON.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

WSLVKELEELQNKQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPST

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000050989 83%
Rat ENSRNOG00000017078 80%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 실험 조건에 맞는 최적 농도는 사용자가 결정해야 합니다.

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.