
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SEC63 Antibody
상품 한눈에 보기
Human SEC63 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 기반 정교한 orthogonal validation을 거쳤습니다. Human, Mouse, Rat에서 반응성이 검증되었습니다.
- 카탈로그번호
- HPA053295-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053295-100 Anti-SEC63 Antibody, SEC63 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053295-25 Anti-SEC63 Antibody, SEC63 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SEC63 Antibody
Anti-SEC63 Antibody
Target: SEC63 homolog (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- WB
- ICC
Orthogonal validation:
Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human SEC63.
Alternative Gene Names
DNAJC23, ERdj2, PRO2507, SEC63L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SEC63 homolog (S. cerevisiae) |
| Target Gene | SEC63 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | REYQEYNPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000019802 (100%), Rat ENSRNOG00000000314 (100%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



