CacheBy
Atlas Antibodies Anti-SDR42E2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SDR42E2 Antibody

상품 한눈에 보기

Human SDR42E2 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원으로 친화 정제됨. IHC 등 연구용에 적합하며, 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA061278-100 Anti-SDR42E2 Antibody, short chain dehydrogenase/reductase family 42E, member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061278-25 Anti-SDR42E2 Antibody, short chain dehydrogenase/reductase family 42E, member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SDR42E2 Antibody

Anti-SDR42E2 Antibody

Target: short chain dehydrogenase/reductase family 42E, member 2 (SDR42E2)
Supplier: Atlas Antibodies
Catalog No.: HPA061278

Product Description

Polyclonal antibody against human SDR42E2.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for use in immunohistochemistry and related research applications.

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    VASYGMSGAEKLQKEQIESINVGGTKLVIDVCVR

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000109392 91%
Rat ENSRNOG00000051819 53%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.