
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SDR42E2 Antibody
상품 한눈에 보기
Human SDR42E2 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원으로 친화 정제됨. IHC 등 연구용에 적합하며, 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA061278-100 Anti-SDR42E2 Antibody, short chain dehydrogenase/reductase family 42E, member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061278-25 Anti-SDR42E2 Antibody, short chain dehydrogenase/reductase family 42E, member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SDR42E2 Antibody
Anti-SDR42E2 Antibody
Target: short chain dehydrogenase/reductase family 42E, member 2 (SDR42E2)
Supplier: Atlas Antibodies
Catalog No.: HPA061278
Product Description
Polyclonal antibody against human SDR42E2.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for use in immunohistochemistry and related research applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
VASYGMSGAEKLQKEQIESINVGGTKLVIDVCVR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000109392 | 91% |
| Rat | ENSRNOG00000051819 | 53% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



