Atlas Antibodies Anti-SDR42E2 Antibody

상품 한눈에 보기

Human SDR42E2 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원으로 친화 정제됨. IHC 등 연구용에 적합하며, 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.

카탈로그번호: HPA061278-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061278-100 Anti-SDR42E2 Antibody, short chain dehydrogenase/reductase family 42E, member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061278-25 Anti-SDR42E2 Antibody, short chain dehydrogenase/reductase family 42E, member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SDR42E2 Antibody

Anti-SDR42E2 Antibody

Target: short chain dehydrogenase/reductase family 42E, member 2 (SDR42E2)
Supplier: Atlas Antibodies
Catalog No.: HPA061278

Product Description

Polyclonal antibody against human SDR42E2.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for use in immunohistochemistry and related research applications.

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
VASYGMSGAEKLQKEQIESINVGGTKLVIDVCVR

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000109392	91%
Rat	ENSRNOG00000051819	53%

Antibody Specifications

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.