
원본
Atlas Antibodies Anti-SDF2 Antibody
상품 한눈에 보기
인간 SDF2 단백질을 인식하는 토끼 유래 폴리클로날 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 반응성(쥐·마우스 97%)을 보입니다. 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.
- 카탈로그번호
- HPA042799-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042799-100 Anti-SDF2 Antibody, stromal cell-derived factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042799-25 Anti-SDF2 Antibody, stromal cell-derived factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SDF2 Antibody
Anti-SDF2 Antibody
Target: Stromal cell-derived factor 2 (SDF2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human SDF2.
Antigen Information
- Target Protein: Stromal cell-derived factor 2
- Target Gene: SDF2
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Epitope Sequence: TVLCNGPYWVRDGEVRFKHSSTEVLLSVTGE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000012121 (97%)
- Mouse ENSMUSG00000002064 (97%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



