Atlas Antibodies Anti-SCRT1 Antibody

상품 한눈에 보기

인체 SCRT1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 정제된 PrEST 항원 기반 친화 정제 방식으로 제조되었으며, 사람과 생쥐에서 교차 반응성이 검증되었습니다. RNA-seq 데이터와 비교한 정교한 단백질 발현 검증 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045265-100 Anti-SCRT1 Antibody, scratch family zinc finger 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045265-25 Anti-SCRT1 Antibody, scratch family zinc finger 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Scratch family zinc finger 1 (SCRT1)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal antibody against human SCRT1.

DKFZp547F072, ZNF898

항목	내용
Target Protein	Scratch family zinc finger 1
Target Gene	SCRT1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse
Interspecies Identity	Rat ENSRNOG00000025594 (96%), Mouse ENSMUSG00000048385 (96%)

Antigen Sequence:

LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand