CacheBy
Thermo Fisher Scientific beta-1 Adrenergic Receptor Polyclonal Antibody
원본

Thermo Fisher Scientific beta-1 Adrenergic Receptor Polyclonal Antibody

상품 한눈에 보기

Human β1-아드레날린 수용체를 인식하는 Rabbit Polyclonal 항체로 Western blot 및 SPR 분석에 적합. 합성 펩타이드 면역원 기반으로 제작되었으며, 고순도 친화 크로마토그래피 정제. PBS 완충액에 0.09% sodium azide 포함, -20°C 보관 권장.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 10:37
Thermo Fisher Scientific PA5113632 beta-1 Adrenergic Receptor Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원

Thermo Fisher Scientific · Thermo Fisher Scientific beta-1 Adrenergic Receptor Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.2–1 µg/mL
Surface Plasmon Resonance (SPR) Assay-dependent

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human ADRB1
Conjugate Unconjugated
Form Liquid
Concentration 0.5 mg/mL
Purification Affinity chromatography
Storage Buffer PBS with 2% sucrose
Contains 0.09% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2884147

Product Specific Information

Immunogen sequence:
CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

  • 단기 보관: 2–8°C에서 최대 1주일
  • 장기 보관: -20°C에서 소량 분주 후 보관 (동결-해동 반복 방지)
  • 예측 상동성: Dog 87%, Guinea Pig 93%, Human 100%, Mouse 100%, Pig 100%, Rabbit 93%, Rat 100%

Target Information

Adrenergic receptors (ARs)는 7-transmembrane domain G-protein-coupled receptor(GPCR) 초가족에 속하며, 내인성 카테콜아민(epinephrine, norepinephrine)과 결합합니다.
현재까지 9개의 수용체 아형이 확인되었으며, α1 (1A/D, 1B, 1C), α2 (2A, 2B, 2C), β (1, 2, 3)로 구분됩니다.

ARs는 고혈압, 심부전, 허혈, 부정맥, 당뇨, 녹내장, 우울증, 발기부전 등 다양한 질환의 발현 및 유지에 관여합니다.
β1AR은 심장 기능, 평활근 긴장도, 대사 조절 등 다양한 생리 과정에 참여하며, B1AR 유전자 결손 마우스는 대부분 태생기에 사망하거나 성체에서 비정상적인 심장 기능을 보입니다.
또한, 갑상선 호르몬에 의한 β1AR 발현 조절은 전사 수준에서 이루어지며, catecholamine-sensitive adenylyl cyclase 시스템에 의해 조절됩니다.
cAMP 반응 요소 결합 단백질(CREM) 계열 전사 인자 연구를 통해 β1AR 조절 메커니즘이 밝혀졌습니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.