CacheBy
Thermo Fisher Scientific MMP3 Polyclonal Antibody
원본

Thermo Fisher Scientific MMP3 Polyclonal Antibody

상품 한눈에 보기

Human MMP3 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western Blot에 적합. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성 제공. Lyophilized 형태로 -20°C 보관. 연구용으로만 사용.

카탈로그번호
PA579683
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 07:59
Thermo Fisher Scientific PA579683 MMP3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific MMP3 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human MMP3 (410–439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746798

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

MMP3 (stromelysin-1)는 peptidase M10A subfamily에 속하는 단백질로, pro-protein 형태로 분비되며 세포 외 단백질분해효소에 의해 활성화됩니다.
이 효소는 zinc 및 calcium 이온과 결합할 수 있으며, metallo-endopeptidase 활성을 가집니다.
활성화된 MMP3는 collagen, gelatin, fibronectin, laminin 등을 분해하며, 상처 치유 및 조직 재형성과 같은 정상 세포 과정에 관여합니다.
유전자 변이는 관상동맥 질환과 관련될 수 있습니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


제품 이미지

Antigen Image
Antigen PDP Image

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.