
원본
Thermo Fisher Scientific MMP3 Polyclonal Antibody
상품 한눈에 보기
Human MMP3 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western Blot에 적합. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성 제공. Lyophilized 형태로 -20°C 보관. 연구용으로만 사용.
- 카탈로그번호
- PA579683
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 07:59
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579683 MMP3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific MMP3 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human MMP3 (410–439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746798 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MMP3 (stromelysin-1)는 peptidase M10A subfamily에 속하는 단백질로, pro-protein 형태로 분비되며 세포 외 단백질분해효소에 의해 활성화됩니다.
이 효소는 zinc 및 calcium 이온과 결합할 수 있으며, metallo-endopeptidase 활성을 가집니다.
활성화된 MMP3는 collagen, gelatin, fibronectin, laminin 등을 분해하며, 상처 치유 및 조직 재형성과 같은 정상 세포 과정에 관여합니다.
유전자 변이는 관상동맥 질환과 관련될 수 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지

Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
