Atlas Antibodies Anti-DPH5 Antibody

상품 한눈에 보기

Human DPH5 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 보장합니다. IHC 등 다양한 응용에 적합하며, Human에 대한 반응성이 검증되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA076234-100 Anti-DPH5 Antibody, diphthamide biosynthesis 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA076234-25 Anti-DPH5 Antibody, diphthamide biosynthesis 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DPH5 Antibody

Anti-DPH5 Antibody

Target Information

Target Protein: diphthamide biosynthesis 5
Target Gene: DPH5
Alternative Gene Names: CGI-30

Product Description

Polyclonal antibody against human DPH5.
Affinity purified using the PrEST antigen as affinity ligand.
Recommended for immunohistochemistry (IHC) and related applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSING

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000033554 (80%)
Rat ENSRNOG00000013719 (79%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	Immunohistochemistry (IHC)
Supplier	Atlas Antibodies