CacheBy
Atlas Antibodies Anti-DPH5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DPH5 Antibody

상품 한눈에 보기

Human DPH5 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 보장합니다. IHC 등 다양한 응용에 적합하며, Human에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076234-100 Anti-DPH5 Antibody, diphthamide biosynthesis 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076234-25 Anti-DPH5 Antibody, diphthamide biosynthesis 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DPH5 Antibody

Anti-DPH5 Antibody

Target Information

  • Target Protein: diphthamide biosynthesis 5
  • Target Gene: DPH5
  • Alternative Gene Names: CGI-30

Product Description

Polyclonal antibody against human DPH5.
Affinity purified using the PrEST antigen as affinity ligand.
Recommended for immunohistochemistry (IHC) and related applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSING

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000033554 (80%)
  • Rat ENSRNOG00000013719 (79%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen
Recommended Applications Immunohistochemistry (IHC)
Supplier Atlas Antibodies

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.