Atlas Antibodies Anti-DPEP1 Antibody

상품 한눈에 보기

Human DPEP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot 검증 완료. Orthogonal 및 재조합 발현 검증을 통해 신뢰성 확보. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA009426-100 Anti-DPEP1 Antibody, dipeptidase 1 (renal) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA009426-25 Anti-DPEP1 Antibody, dipeptidase 1 (renal) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: dipeptidase 1 (renal)
Supplier: Atlas Antibodies

IHC (Orthogonal Validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
WB (Recombinant Expression Validation): Validation using target protein overexpression.

Polyclonal antibody against Human DPEP1.

항목	내용
Target Protein	dipeptidase 1 (renal)
Target Gene	DPEP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	VMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFQAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGAS
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000015880 (72%), Mouse ENSMUSG00000019278 (71%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet