CacheBy
Atlas Antibodies Anti-DONSON Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DONSON Antibody

상품 한눈에 보기

Human DONSON 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Western Blot 및 Immunohistochemistry에 적합. 높은 종간 반응성(마우스 90%, 랫 88%). PrEST 항원으로 친화 정제됨. 안정한 PBS/glycerol buffer 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049033-100 Anti-DONSON Antibody, downstream neighbor of SON 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049033-25 Anti-DONSON Antibody, downstream neighbor of SON 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DONSON Antibody

Anti-DONSON Antibody

Target: downstream neighbor of SON
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human DONSON.


Alternative Gene Names

B17, C21orf60, C2TA, DKFZP434M035

Open Datasheet


Target Information

항목 내용
Target Protein downstream neighbor of SON
Target Gene DONSON
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDPKLSSELRCTFQQSLIYWLHPALSWLPLFPRIG

Verified Species Reactivity

Human

Interspecies Information

Ortholog ID 항원 서열 동일성
Mouse ENSMUSG00000022960 90%
Rat ENSRNOG00000002012 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.