CacheBy
Atlas Antibodies Anti-DOK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DOK1 Antibody

상품 한눈에 보기

Human DOK1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 적합하며, 높은 종간 보존성을 보임. 안정적인 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048561-100 Anti-DOK1 Antibody, docking protein 1, 62kDa (downstream of tyrosine kinase 1) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048561-25 Anti-DOK1 Antibody, docking protein 1, 62kDa (downstream of tyrosine kinase 1) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DOK1 Antibody

Anti-DOK1 Antibody

Target: Docking protein 1, 62kDa (Downstream of Tyrosine Kinase 1)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DOK1.

Alternative Gene Names

  • p62dok

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Docking protein 1, 62kDa (downstream of tyrosine kinase 1)
Target Gene DOK1
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007412 (79%), Mouse ENSMUSG00000068335 (77%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence AQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Storage Buffer

구성 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.