CacheBy
Atlas Antibodies Anti-DNPH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DNPH1 Antibody

상품 한눈에 보기

인간 DNPH1 단백질을 인식하는 폴리클로날 항체. IHC 및 Western blot에 적합하며, RNA-seq 데이터 기반 정교한 직교 검증 수행. 토끼 유래 IgG로 제작되어 높은 특이성과 재현성을 제공. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029675-100 Anti-DNPH1 Antibody, 2`-deoxynucleoside 5`-phosphate N-hydrolase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029675-25 Anti-DNPH1 Antibody, 2`-deoxynucleoside 5`-phosphate N-hydrolase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DNPH1 Antibody

Anti-DNPH1 Antibody

2'-deoxynucleoside 5'-phosphate N-hydrolase 1

  • IHC (Orthogonal validation): Protein expression verified using IHC compared to RNA-seq data in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human DNPH1.

Alternative Gene Names

C6orf108, dJ330M21.3, rcl

Open Datasheet

Target Information

항목 내용
Target Protein 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
Target Gene DNPH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQ
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000018397 (86%), Mouse ENSMUSG00000040658 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.