AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DNPEP Antibody
상품 한눈에 보기
DNPEP 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit IgG 형태이며, PrEST 항원으로 친화 정제되었습니다. 인간, 생쥐, 랫트에 반응하며, 정확한 단백질 발현 검증을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036398-100 Anti-DNPEP Antibody, aspartyl aminopeptidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036398-25 Anti-DNPEP Antibody, aspartyl aminopeptidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DNPEP Antibody
Anti-DNPEP Antibody
Target Protein: Aspartyl Aminopeptidase
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Western Blot (WB)
Product Description
Polyclonal antibody against human DNPEP.
Alternative Gene Names
ASPEP, DAP
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHAVHPNYLD
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000019772 | 91% |
| Mouse | ENSMUSG00000026209 | 90% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.