CacheBy
Atlas Antibodies Anti-DNPEP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DNPEP Antibody

상품 한눈에 보기

DNPEP 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit IgG 형태이며, PrEST 항원으로 친화 정제되었습니다. 인간, 생쥐, 랫트에 반응하며, 정확한 단백질 발현 검증을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036398-100 Anti-DNPEP Antibody, aspartyl aminopeptidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036398-25 Anti-DNPEP Antibody, aspartyl aminopeptidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DNPEP Antibody

Anti-DNPEP Antibody

Target Protein: Aspartyl Aminopeptidase
Supplier: Atlas Antibodies

  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Western Blot (WB)

Product Description

Polyclonal antibody against human DNPEP.

Alternative Gene Names

ASPEP, DAP

Open Datasheet (PDF)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHAVHPNYLD

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019772 91%
Mouse ENSMUSG00000026209 90%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.