Atlas Antibodies Anti-DNHD1 Antibody
상품 한눈에 보기
Human DNHD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, 40% 글리세롤 기반 완충용액에 보존됨. 사람에 특이적 반응을 보이며 설치류와 높은 서열 유사성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DNHD1 Antibody
Target Information
- Target Protein: Dynein heavy chain domain 1
- Target Gene: DNHD1
- Alternative Gene Names: C11orf47, CCDC35, DHCD1, DKFZp686J0796, DNHD1L, FLJ32752, FLJ35709, FLJ46184
Product Description
Polyclonal antibody against human DNHD1, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunohistochemistry (IHC)
Antigen Information
Antigen Sequence (PrEST):
KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat: ENSRNOG00000051291 (76%)
- Mouse: ENSMUSG00000030882 (73%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Instructions | Gently mix before use. Determine optimal concentrations and conditions experimentally. |
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.