Atlas Antibodies Anti-DNHD1 Antibody

상품 한눈에 보기

Human DNHD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, 40% 글리세롤 기반 완충용액에 보존됨. 사람에 특이적 반응을 보이며 설치류와 높은 서열 유사성을 가짐.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039698-100 Anti-DNHD1 Antibody, dynein heavy chain domain 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039698-25 Anti-DNHD1 Antibody, dynein heavy chain domain 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Dynein heavy chain domain 1
Target Gene: DNHD1
Alternative Gene Names: C11orf47, CCDC35, DHCD1, DKFZp686J0796, DNHD1L, FLJ32752, FLJ35709, FLJ46184

Polyclonal antibody against human DNHD1, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence (PrEST):
KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW

Highest antigen sequence identity to orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Instructions	Gently mix before use. Determine optimal concentrations and conditions experimentally.