CacheBy
Atlas Antibodies Anti-DLK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DLK2 Antibody

상품 한눈에 보기

인간 DLK2 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070955-100 Anti-DLK2 Antibody, delta like non-canonical Notch ligand 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070955-25 Anti-DLK2 Antibody, delta like non-canonical Notch ligand 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DLK2 Antibody

Anti-DLK2 Antibody

Target Information

  • Target Protein: delta-like 2 homolog (Drosophila)
  • Target Gene: DLK2
  • Alternative Gene Names: EGFL9, MGC2487

Product Description

Polyclonal antibody against human DLK2.

  • Immunohistochemistry (IHC)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000047428 91%
Rat ENSRNOG00000018949 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 희석 배수와 조건은 사용자가 실험 조건에 따라 결정해야 합니다.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.