CacheBy
Atlas Antibodies Anti-DLST Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DLST Antibody

상품 한눈에 보기

Human DLST 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003010-100 Anti-DLST Antibody, dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003010-25 Anti-DLST Antibody, dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DLST Antibody

Anti-DLST Antibody

Target: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Genetic validation in WB by siRNA knockdown.

Product Description

Polyclonal antibody against human DLST.


Alternative Gene Names

  • DLTS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Target Gene DLST
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000004789 (96%), Rat ENSRNOG00000005061 (96%)

Buffer

40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.