Atlas Antibodies Anti-DHRS11 Antibody

상품 한눈에 보기

Human DHRS11 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형 항체로, IHC 및 ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품. Affinity purification 방식으로 높은 특이도 확보.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053623-100 Anti-DHRS11 Antibody, dehydrogenase/reductase (SDR family) member 11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053623-25 Anti-DHRS11 Antibody, dehydrogenase/reductase (SDR family) member 11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DHRS11 Antibody

Anti-DHRS11 Antibody

Target: dehydrogenase/reductase (SDR family) member 11
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC).

Product Description

Polyclonal antibody against Human DHRS11.

Alternative Gene Names: MGC4172, SDR24C1
Datasheet: Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	dehydrogenase/reductase (SDR family) member 11
Target Gene	DHRS11
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000034449 (92%), Rat ENSRNOG00000027891 (92%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTE

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand