
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DHPS Antibody
상품 한눈에 보기
인간 DHPS 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 기반으로 검증된 신뢰성 높은 항체이며, 토끼 유래 IgG 형태로 친화 정제되어 제공합니다.
- 카탈로그번호
- HPA029413-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029413-100 Anti-DHPS Antibody, deoxyhypusine synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029413-25 Anti-DHPS Antibody, deoxyhypusine synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DHPS Antibody
Anti-DHPS Antibody
Target: deoxyhypusine synthase (DHPS)
Type: Polyclonal Antibody against Human DHPS
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Alternative Gene Names
- MIG13
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | deoxyhypusine synthase |
| Target Gene | DHPS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVE |
Species Reactivity
| Verified Species | Human |
|---|---|
| Rat Ortholog | ENSRNOG00000004219 (95%) |
| Mouse Ortholog | ENSMUSG00000060038 (93%) |
Product Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage & Handling | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| Safety Data | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



