CacheBy
Atlas Antibodies Anti-DGKI Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DGKI Antibody

상품 한눈에 보기

Human DGKI를 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형태입니다. Recombinant PrEST 항원을 이용해 친화 정제되었으며, 인간 DGKI 단백질 검출에 적합합니다. ICC 등 다양한 응용에 사용 가능하며, PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021924-100 Anti-DGKI Antibody, diacylglycerol kinase, iota 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021924-25 Anti-DGKI Antibody, diacylglycerol kinase, iota 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DGKI Antibody

Anti-DGKI Antibody

Target Information

  • Target Protein: diacylglycerol kinase, iota
  • Target Gene: DGKI
  • Alternative Gene Names: DGK-IOTA
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DGKI.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    IRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHET

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000026705) – 97%
  • Mouse (ENSMUSG00000038665) – 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.