CacheBy
Atlas Antibodies Anti-DGKA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DGKA Antibody

상품 한눈에 보기

Human DGKA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반 Orthogonal 검증 완료. DAGK, DGK1, DGK-alpha 대체명으로도 알려진 DGKA 타깃에 특이적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045462-100 Anti-DGKA Antibody, diacylglycerol kinase, alpha 80kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045462-25 Anti-DGKA Antibody, diacylglycerol kinase, alpha 80kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DGKA Antibody

Anti-DGKA Antibody

Target: diacylglycerol kinase, alpha 80kDa
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against Human DGKA.


Alternative Gene Names

DAGK, DAGK1, DGK-alpha

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein diacylglycerol kinase, alpha 80kDa
Target Gene DGKA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP
Verified Species Reactivity Human
Interspecies Homology Mouse: 74% (ENSMUSG00000025357), Rat: 73% (ENSRNOG00000022943)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.