Atlas Antibodies Anti-DEPP1 Antibody

상품 한눈에 보기

인간 DEPP1 단백질을 인식하는 토끼 폴리클로날 항체. 자가포식 조절 단백질 연구용. PrEST 항원을 이용한 친화 정제 방식. 면역세포화학(ICC) 등 다양한 응용에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037818-100 Anti-DEPP1 Antibody, DEPP1, autophagy regulator 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037818-25 Anti-DEPP1 Antibody, DEPP1, autophagy regulator 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: DEPP1, autophagy regulator
Type: Polyclonal Antibody against Human DEPP1

Polyclonal antibody raised in rabbit against the human DEPP1 (DEPP1, autophagy regulator) protein.

C10orf10, DEPP, FIG, Fseg

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSH

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000023465	52%
Mouse	ENSMUSG00000048489	50%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet