CacheBy
Atlas Antibodies Anti-DECR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DECR1 Antibody

상품 한눈에 보기

Human DECR1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교 확인. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023162-100 Anti-DECR1 Antibody, 2,4-dienoyl CoA reductase 1, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023162-25 Anti-DECR1 Antibody, 2,4-dienoyl CoA reductase 1, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DECR1 Antibody

Anti-DECR1 Antibody

2,4-dienoyl CoA reductase 1, mitochondrial


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human DECR1


Alternative Gene Names

DECR, SDR18C1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein 2,4-dienoyl CoA reductase 1, mitochondrial
Target Gene DECR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDP
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028223 (90%), Rat ENSRNOG00000008236 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.