CacheBy
Atlas Antibodies Anti-DDX60 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX60 Antibody

상품 한눈에 보기

Human DDX60 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046952-100 Anti-DDX60 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046952-25 Anti-DDX60 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX60 Antibody

Anti-DDX60 Antibody

Target: DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 (DDX60)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DDX60 protein.

Alternative Gene Names

  • FLJ20035

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
Target Gene DDX60
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV
Verified Species Reactivity Human
Interspecies Homology Rat (73%, ENSRNOG00000059097), Mouse (67%, ENSMUSG00000037921)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.