CacheBy
Atlas Antibodies Anti-DDX54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX54 Antibody

상품 한눈에 보기

인간 DDX54 단백질을 인식하는 토끼 폴리클로날 항체. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 적합하며, 40% 글리세롤 기반 PBS 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028244-100 Anti-DDX54 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028244-25 Anti-DDX54 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX54 Antibody

Anti-DDX54 Antibody

Target: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 (DDX54)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human DDX54.


Alternative Gene Names

APR-5, DP97, MGC2835

Open Datasheet


Target Information

항목 내용
Target Protein DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Target Gene DDX54
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence (Epitope) VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFP
Verified Species Reactivity Human
Interspecies Identity Mouse (91%, ENSMUSG00000029599), Rat (91%, ENSRNOG00000001377)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.