CacheBy
Atlas Antibodies Anti-DDX39B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX39B Antibody

상품 한눈에 보기

인간 DDX39B 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 프레스티지 항원으로 친화 정제되었습니다. 높은 종 간 서열 일치도를 보여 인간, 생쥐, 랫드에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058450-100 Anti-DDX39B Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058450-25 Anti-DDX39B Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX39B Antibody

Anti-DDX39B Antibody

Target Protein: DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DDX39B.


Alternative Gene Names

BAT1, D6S81E, UAP56

Open Datasheet


Target Information

항목 내용
Target Protein DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
Target Gene DDX39B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (100%), Mouse (100%)
Clonality Polyclonal
Isotype IgG
Host Rabbit

Antigen Sequence

YVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATL


Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.