Atlas Antibodies Anti-DDX21 Antibody

상품 한눈에 보기

인간 DDX21 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에서 RNA-seq 데이터와 비교한 정교한 Orthogonal 검증을 거침. 토끼 유래 IgG이며 PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 다양한 조직·세포주 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036592-100 Anti-DDX21 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 21 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036592-25 Anti-DDX21 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 21 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

DEAD (Asp-Glu-Ala-Asp) box helicase 21

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Orthogonal Validation
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC

Polyclonal Antibody against Human DDX21

GURDB, RH-II/GU

항목	내용
Target Protein	DEAD (Asp-Glu-Ala-Asp) box helicase 21
Target Gene	DDX21
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000048990 (58%), Mouse ENSMUSG00000020075 (53%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand