CacheBy
Atlas Antibodies Anti-DDX21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX21 Antibody

상품 한눈에 보기

인간 DDX21 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에서 RNA-seq 데이터와 비교한 정교한 Orthogonal 검증을 거침. 토끼 유래 IgG이며 PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 다양한 조직·세포주 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036592-100 Anti-DDX21 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036592-25 Anti-DDX21 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX21 Antibody

Anti-DDX21 Antibody

DEAD (Asp-Glu-Ala-Asp) box helicase 21


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Orthogonal Validation
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC


Product Description

Polyclonal Antibody against Human DDX21


Alternative Gene Names

GURDB, RH-II/GU

Open Datasheet


Target Information

항목 내용
Target Protein DEAD (Asp-Glu-Ala-Asp) box helicase 21
Target Gene DDX21
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000048990 (58%), Mouse ENSMUSG00000020075 (53%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.