CacheBy
Atlas Antibodies Anti-DDX17 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX17 Antibody

상품 한눈에 보기

Human DDX17 단백질을 인식하는 Rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터 기반 단백질 발현 검증이 가능합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063142-100 Anti-DDX17 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063142-25 Anti-DDX17 Antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX17 Antibody

Anti-DDX17 Antibody

Target: DEAD (Asp-Glu-Ala-Asp) box helicase 17
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation by comparison to RNA-seq data of corresponding target in high and low expression tissues)
  • WB
  • ICC

Product Description

Polyclonal antibody against human DDX17.


Alternative Gene Names

  • P72

Open Datasheet


Target Information

항목 내용
Target Protein DEAD (Asp-Glu-Ala-Asp) box helicase 17
Target Gene DDX17
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000051170 96%
Mouse ENSMUSG00000055065 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.