Atlas Antibodies Anti-SCG3 Antibody

상품 한눈에 보기

Human SCG3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Recombinant Expression Validation 적용. 높은 특이성과 재현성을 제공하며, 친화 정제된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006880-100 Anti-SCG3 Antibody, secretogranin III 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006880-25 Anti-SCG3 Antibody, secretogranin III 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: secretogranin III (SCG3)
Supplier: Atlas Antibodies

IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human SCG3

FLJ90833, SGIII

항목	내용
Target Protein	secretogranin III
Target Gene	SCG3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand