Atlas Antibodies Anti-SCEL Antibody

상품 한눈에 보기

인간 SCEL 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 정제된 PrEST 항원을 사용해 제작되었으며, 오소고날 검증을 통해 RNA-seq 데이터와 단백질 발현을 비교 확인하였습니다. 토끼 유래 IgG 항체로, 글리세롤 및 PBS 완충액에 보존됩니다.

카탈로그번호: HPA040154-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040154-100 Anti-SCEL Antibody, sciellin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040154-25 Anti-SCEL Antibody, sciellin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SCEL Antibody

Anti-SCEL Antibody

Target: sciellin (SCEL)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation)
WB (Western Blot)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human SCEL.

Alternative Gene Names

FLJ21667
MGC22531

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	sciellin
Target Gene	SCEL
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYS

Verified Species Reactivity

Human

Interspecies Information

종	Ortholog ID	항원 서열 일치율
Rat	ENSRNOG00000024237	78%
Mouse	ENSMUSG00000022123	75%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand