CacheBy
Atlas Antibodies Anti-SCAMP5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCAMP5 Antibody

상품 한눈에 보기

인간 SCAMP5 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 인간, Rat, Mouse 종에 100% 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046645-100 Anti-SCAMP5 Antibody, secretory carrier membrane protein 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046645-25 Anti-SCAMP5 Antibody, secretory carrier membrane protein 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCAMP5 Antibody

Anti-SCAMP5 Antibody

Target: Secretory carrier membrane protein 5 (SCAMP5)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human SCAMP5.


Alternative Gene Names

  • MGC24969

Open Datasheet (PDF)


Antigen Information

  • Target Protein: Secretory carrier membrane protein 5
  • Target Gene: SCAMP5
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000054008 100%
Mouse ENSMUSG00000040722 100%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.