
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SCAF8 Antibody
상품 한눈에 보기
인간 SCAF8 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 검증을 통해 높은 신뢰도를 제공하며, 친화 정제 방식으로 제조된 고품질 제품입니다. Rabbit IgG 포맷으로 PBS/glycerol buffer에 보존됩니다.
- 카탈로그번호
- HPA035601-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035601-100 Anti-SCAF8 Antibody, SR-related CTD-associated factor 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035601-25 Anti-SCAF8 Antibody, SR-related CTD-associated factor 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SCAF8 Antibody
Anti-SCAF8 Antibody
SR-related CTD-associated factor 8
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC
Validation performed by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human SCAF8
Alternative Gene Names
KIAA1116, RBM16
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SR-related CTD-associated factor 8 |
| Target Gene | SCAF8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016919 (79%), Mouse ENSMUSG00000046201 (78%) |
Antigen Sequence
LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



