CacheBy
Atlas Antibodies Anti-SAMD9L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SAMD9L Antibody

상품 한눈에 보기

Human SAMD9L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 독립 항체 검증을 통해 신뢰도 높은 단백질 발현 분석이 가능합니다. 40% 글리세롤 PBS 버퍼에 보존됩니다.

카탈로그번호
HPA019465-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019465-100 Anti-SAMD9L Antibody, sterile alpha motif domain containing 9-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019465-25 Anti-SAMD9L Antibody, sterile alpha motif domain containing 9-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SAMD9L Antibody

Anti-SAMD9L Antibody

Target: sterile alpha motif domain containing 9-like (SAMD9L)
Supplier: Atlas Antibodies

  • IHC (Independent antibody validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • ICC

Product Description

Polyclonal antibody against human SAMD9L.

Alternative Gene Names

C7orf6, FLJ39885, KIAA2005

Open Datasheet

Target Information

항목 내용
Target Protein sterile alpha motif domain containing 9-like
Target Gene SAMD9L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000051922 (67%), Mouse ENSMUSG00000047735 (67%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

ECYLALSKFTSHLKNLQSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKESQLLQEENCRKKLEALRADRFAGLLEYLNPNYKDAT

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.