CacheBy
Atlas Antibodies Anti-SAMD4A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SAMD4A Antibody

상품 한눈에 보기

인간 SAMD4A 단백질을 타깃으로 하는 폴리클로날 항체입니다. IHC 및 WB 실험에 적합하며, 토끼 유래 IgG 형태로 정제되었습니다. 인간, 마우스, 랫트에서 반응성이 검증되었습니다. 프레스트 항원으로 특이적 친화 정제된 고품질 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA065309-100 Anti-SAMD4A Antibody, sterile alpha motif domain containing 4A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065309-25 Anti-SAMD4A Antibody, sterile alpha motif domain containing 4A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SAMD4A Antibody

Anti-SAMD4A Antibody

Target: Sterile alpha motif domain containing 4A
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SAMD4A.


Alternative Gene Names

DKFZP434H0350, hSmaug1, KIAA1053, SAMD4, Smaug, SMG, SMGA

Open Datasheet


Target Information

항목 내용
Target Protein Sterile alpha motif domain containing 4A
Target Gene SAMD4A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000010489 (95%), Mouse ENSMUSG00000021838 (94%)

Antigen Sequence:
MWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSRDSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTS


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.