Atlas Antibodies Anti-SAMD15 Antibody

상품 한눈에 보기

Human SAMD15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현을 비교 검증하였습니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤/PBS 버퍼에 보존됩니다.

카탈로그번호: HPA030673-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030673-100 Anti-SAMD15 Antibody, sterile alpha motif domain containing 15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030673-25 Anti-SAMD15 Antibody, sterile alpha motif domain containing 15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SAMD15 Antibody

Anti-SAMD15 Antibody

Target: sterile alpha motif domain containing 15 (SAMD15)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human SAMD15.

Alternative Gene Names

C14orf174, FAM15A, FLJ35963

Target Information

항목	내용
Target Protein	sterile alpha motif domain containing 15
Target Gene	SAMD15
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLEQKGHTGIKSDSLTLSEFVKAAGLQDYAPEITAPE
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000090812 (78%), Rat ENSRNOG00000004667 (24%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)