Atlas Antibodies Anti-S1PR1 Antibody

상품 한눈에 보기

Human S1PR1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, Human에 대해 검증됨. 40% glycerol 및 PBS buffer로 안정화되어 장기 보관 가능.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA075568-100 Anti-S1PR1 Antibody, sphingosine-1-phosphate receptor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA075568-25 Anti-S1PR1 Antibody, sphingosine-1-phosphate receptor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-S1PR1 Antibody

Anti-S1PR1 Antibody

Target Information

Target Protein: sphingosine-1-phosphate receptor 1
Target Gene: S1PR1
Alternative Gene Names: CD363, D1S3362, edg-1, EDG1

Product Description

Polyclonal Antibody against Human S1PR1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000045092 (81%)
Rat ENSRNOG00000013683 (75%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand