
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-S100A6 Antibody
상품 한눈에 보기
Human S100A6 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 신뢰성 검증 완료. PrEST 항원을 이용해 affinity purification 수행. Human, Mouse, Rat 반응 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA007575-100 Anti-S100A6 Antibody, S100 calcium binding protein A6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007575-25 Anti-S100A6 Antibody, S100 calcium binding protein A6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-S100A6 Antibody
Anti-S100A6 Antibody
S100 calcium binding protein A6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
- ICC (Immunocytochemistry)
Orthogonal validation:
Protein expression verified using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human S100A6
Alternative Gene Names
2A9, CABP, CACY, PRA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | S100 calcium binding protein A6 |
| Target Gene | S100A6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000001025 (96%), Rat ENSRNOG00000011647 (95%) |
Antigen Sequence:
AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



