CacheBy
Atlas Antibodies Anti-S100A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-S100A2 Antibody

상품 한눈에 보기

Human S100A2 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot 분석에 적합합니다. Rabbit 유래 IgG 항체이며, 정제된 PrEST 항원으로 친화 정제되었습니다. 인간 시료에 검증되었으며 CAN19, S100L 유전자와 관련 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062451-100 Anti-S100A2 Antibody, S100 calcium binding protein A2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062451-25 Anti-S100A2 Antibody, S100 calcium binding protein A2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-S100A2 Antibody

Anti-S100A2 Antibody

S100 calcium binding protein A2


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human S100A2


Alternative Gene Names

CAN19, S100L

Open Datasheet


Target Information

항목 내용
Target Protein S100 calcium binding protein A2
Target Gene S100A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVD
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000094018 (64%), Rat ENSRNOG00000011821 (56%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.