Atlas Antibodies Anti-S100A11 Antibody

상품 한눈에 보기

Human S100A11 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 RNA-seq 기반 정교한 단백질 발현 검증에 적합. PrEST 항원으로 친화 정제된 고품질 항체로 높은 특이성과 재현성을 제공. Human 종에 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042745-100 Anti-S100A11 Antibody, S100 calcium binding protein A11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042745-25 Anti-S100A11 Antibody, S100 calcium binding protein A11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

S100 calcium binding protein A11

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human S100A11.

항목	내용
Target Protein	S100 calcium binding protein A11
Target Gene	S100A11
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSF

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand