CacheBy
Atlas Antibodies Anti-RUNDC3A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RUNDC3A Antibody

상품 한눈에 보기

인간 RUNDC3A 단백질을 타겟으로 하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 독립 항체 비교를 통한 검증 완료. 토끼 숙주에서 생산되었으며, 높은 종간 반응성(인간·흰쥐·쥐) 확인. PrEST 항원으로 친화 정제된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070733-100 Anti-RUNDC3A Antibody, RUN domain containing 3A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070733-25 Anti-RUNDC3A Antibody, RUN domain containing 3A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RUNDC3A Antibody

Anti-RUNDC3A Antibody

Target: RUN domain containing 3A
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human RUNDC3A


Alternative Gene Names

  • RAP2IP
  • RPIP8

Target Information

항목 내용
Target Protein RUN domain containing 3A
Target Gene RUNDC3A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Rat
Interspecies Identity Mouse ENSMUSG00000006575 (93%), Rat ENSRNOG00000020970 (85%)

Antigen Sequence:
LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 농도/조건
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.